OX40L/TNFSF4 Protein, Rabbit, Recombinant (His & Myc)

SKU: orb1976706

Description

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His & Myc) is expressed in yeast with C-6xHis, Myc tag. The predicted molecular weight is 19.8 kDa and the accession number is O02765.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Rabbit
• Biological Activity: Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His & Myc) is expressed in yeast with C-6xHis, Myc tag. The predicted molecular weight is 19.8 kDa and the accession number is O02765.
• Tag: C-6xHis, Myc
• Expression Region: 45-187 aa
• MW: 19.8 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

O02765