OXT Protein, Human, Recombinant (His)

SKU: orb1978096

Description

Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Biological Activity: Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
• Tag: N-6xHis
• Expression Region: 32-125 aa
• MW: 11.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P01178