OXYR Rabbit Polyclonal Antibody

SKU: orb55707

Description

Rabbit polyclonal antibody to OXTR.

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Signaling Pathways/GPCR,Epigenetics,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Tissue Specific & Cell Marker,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OXYR
• Target: OXYR
• Protein Sequence: Synthetic peptide located within the following region: LFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQ
• Molecular Weight: 42 kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 - 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

OT-R

Quick Database Links

Gene Symbol

OXYR

UniProt

P30559

RefSeq (Protein):NP_000907

Michal Hubert Wrobel 1, Jaroslaw Mlynarczuk 2, Robert Rekawiecki Effects of commonly used carbamates (carbaryl and thiram) on the regulatory, secretory and motor functions of bovine cervixes in vitro Theriogenology ., (2024)

PubMed: 38330862

Applications

WB

Reactivity

Bovine