PAK1 monoclonal antibody (M02), clone 4D1

SKU: orb2292464

Description

Mouse monoclonal antibody raised against a partial recombinant PAK1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 kappa
• Clone No.: 4D1
• Immunogen: PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged PAK1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35 ug/ml]

Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.

Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody (M02), clone 4D1. Lane 1: PAK1 transfected lysate (Predicted MW: 49.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).

Quick Database Links

RefSeq (Protein):NP_002567