You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Developmental Biology,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Research Areas/Cancer,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Products/Polyclonal Antibodies/Various,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−
Item 1 of 7
| Tested Applications | WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAX4 |
| Target | PAX4 |
| Protein Sequence | Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
| Molecular Weight | 38 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti KPD antibody, anti MGC129960 antibody, anti MODY9 antibody
Similar Products
−- Item 1 of 4
- Item 1 of 4
- Item 1 of 1
Anti-PAX4 Antibody [orb412345]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
PAX4 Rabbit Polyclonal Antibody [orb329686]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
Human
Rabbit
Polyclonal
Unconjugated
100 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks