You have no items in your shopping cart.
PDIA3 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, IP, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | PDIA3 |
| Protein Sequence | Synthetic peptide located within the following region: YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE |
| Molecular Weight | 56kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ERp57 Polyclonal Antibody [orb1411550]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μlERp57 Rabbit Polyclonal Antibody [orb183430]
IF, IHC-Fr, IHC-P, WB
Gallus, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Amount and Sample Type: 500 ug Human NT2 cell lysate, Amount of IP Antibody: 6 ug, Primary Antibody: PDIA3, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: PDIA3.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. PDIA3 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

IP Suggested Anti-PDIA3 Antibody Positive Control: NT2 CELL/BRAIN TISSUE.

PDIA3 antibody - C-terminal region (orb585694) validated by WB using Fetal Kidney Lysate at 1.0 ug/ml.

Sample Type: NT2 cells, Red: Antibody, Blue: DAPI, Primary dilution: 1 ug/50 ul antibody, Secondary Antibody: Alexa goat anti-rabbit 594.

Sample Type: Human brain stem cells, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: PDIA3: Red DAPI:Blue, Gene Name: PDIA3.
Documents Download
Request a Document
Protocol Information
PDIA3 Rabbit Polyclonal Antibody (orb585694)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



















