You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Products/Proteins/Peptides,Neuropeptide Y receptors
Images & Validation
−
Key Properties
−| CAS Number | 126339-09-1 |
|---|---|
| MW | 4049.6 Da |
| Purity | > 95% by HPLC |
| Formula | C180H279N53O54 |
| Protein Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1GH120, PYY (3-36), PYY1-36, Y2 receptor agonist, appetite , food intake, metabolite, weight gain
Similar Products
−Human PYY ELISA Kit [orb406221]
Human
62.5 pg/mL-4000 pg/mL
15.6 pg/mL
96 T, 10 x 96 T, 5 x 96 T, 48 T, 24 TPeptide YY (PYY) (3-36), human [orb2655234]
> 98% (HPLC)
126339-09-1
3980.4
C176H272N52O54
500 mg, 200 mg, 100 mg, 50 mg, 25 mg, 10 mg, 5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Peptide YY (3-36) (human) (orb1147055)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


