You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Equine, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PER2 |
| Target | PER2 |
| Protein Sequence | Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ |
| Molecular Weight | 137 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Per2 (phospho Ser662) rabbit pAb [orb770771]
ELISA, IHC-P, WB
Human, Mouse
Polyclonal
Unconjugated
100 μl, 50 μlAnti-PER2 (Phospho-S662) Antibody [orb338964]
IH, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μlPER2 Rabbit Polyclonal Antibody [orb500690]
IF, IHC-Fr, IHC-P
Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 137 kDa, 98 kDa and 80 kDa. The protein may be modified by phosphorylation and/or acetylation.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: Hum. 721_B, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Hum. Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. MCF7, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.
Documents Download
Request a Document
PER2 Rabbit Polyclonal Antibody (orb577174)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











