You have no items in your shopping cart.
Description
Images & Validation
−Item 1 of 3
| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Mouse |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Polyclonal |
| Immunogen | PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. |
| Protein Sequence | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | 50 % glycerol |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PFN1 polyclonal antibody (A01), Western Blot analysis of PFN1 expression in HeLa.

PFN1 polyclonal antibody (A01), Western Blot analysis of PFN1 expression in Raw 264.7.

Western Blot detection against Immunogen (41.51 KDa).
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
PFN1 polyclonal antibody (A01) (orb2292420)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review