PHB monoclonal antibody (M01), clone 3F4-2B2

SKU: orb2292410

Description

Mouse monoclonal antibody raised against a full length recombinant PHB.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a kappa
• Clone No.: 3F4-2B2
• Immunogen: PHB (AAH13401, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged PHB is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PHB on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 5 ug/ml]

Immunoperoxidase of monoclonal antibody to PHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]

PHB monoclonal antibody (M01), clone 3F4-2B2 Western Blot analysis of PHB expression in Hela.

PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in NIH/3T3.

PHB monoclonal antibody (M01), clone 3F4-2B2. Western Blot analysis of PHB expression in PC-12.

Western Blot detection against Immunogen (55.66 KDa).

Quick Database Links

RefSeq:AAH13401