You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, IP, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 kappa |
| Clone No. | 4A3-1D6 |
| Immunogen | PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged PHGDH is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PHGDH on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1 ~ 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]

Immunoprecipitation of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHGDH MaxPab rabbit polyclonal antibody.

PHGDH monoclonal antibody (M01), clone 4A3-1D6 Western Blot analysis of PHGDH expression in Jurkat.

PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in A-431.

PHGDH monoclonal antibody (M01), clone 4A3-1D6. Western Blot analysis of PHGDH expression in human liver.

Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody (M01), clone 4A3-1D6. Lane 1: PHGDH transfected lysate(56.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (84.37 KDa).
Quick Database Links
NCBI Reference Sequences
−| RefSeq | AAH11262.1 |
|---|
Documents Download
Request a Document
Protocol Information
PHGDH monoclonal antibody (M01), clone 4A3-1D6 (orb2291269)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review