You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Swine |
| Target | IL-1 beta |
| Protein Length | 153 |
| MW | 17.6 kDa |
| Purity | 98% |
| Protein Sequence | ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP (153) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1F2
Similar Products
−- Item 1 of 1
Porcine IL-1 beta protein [orb107741]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
17.6 kDa
10 μg, 100 μg, 500 μg Porcine IL 1 beta Protein [orb80409]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
1 mg, 2 μg, 10 μgPorcine IL-1b protein [orb633356]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
17.5 KDa
E.Coli
1 mg, 100 μg, 200 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days