Porcine IL-6 protein

SKU: orb1216317

Description

The Swine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-6 Specifications: (Molecular Weight: 20.9 kDa) (Amino Acid Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)) (Gene ID: 399500).

Research Area

Product Categories/Products/Proteins

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Swine
Target	IL-6
Protein Length	183
MW	20.9 kDa
Purity	98%
Protein Sequence	GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IL-6

NCBI Gene ID

399500

NCBI Gene Details

−

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols