Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Porcine TNF alpha protein

SKU: orb1215718

Description

The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086).

Research Area

Product Categories/Products/Proteins

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetTNF alpha
Protein Length154
MW16.9 kDa
Purity98%
Protein SequenceSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNFSF2

Similar Products

  • Porcine TNF alpha protein [orb1216340]

    98%

    16.9 kDa

    Yeast

    100 μg
  • Porcine TNFA protein [orb633345]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    17.2 KDa

    E.Coli

    200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 310.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry