Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Ppargc1a Rabbit Polyclonal Antibody

SKU: orb330035

Description

Rabbit polyclonal antibody to Ppargc1a

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetPpargc1a
Protein SequenceSynthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD
Molecular Weight90kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti A830037N07Rik antibody, anti PGC-1 antibody, anti PGC-1v antibody, anti Pgc-1alpha antibody, anti Pgc1 antibody, anti Pgco1 antibody, anti Ppargc1 antibody, anti Gm11133 antibody, anti ENSMUSG00000079510 antibody

Similar Products

  • PGC1 alpha + beta Rabbit Polyclonal Antibody [orb100963]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb317701]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb330034]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb1974626]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb329608]

    ICC,  IF,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ppargc1a Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug cytosolic fraction mesangial cells, Lane 2: 20 ug cytosolic fraction mesangial cells, Lane 3: 20 ug mitochondrial fraction mesangial cells, Lane 4: 20 ug treated cytosolic fraction mesangial cells, Lane 5: 20 ug Myometrial tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: PGC1 alpha.

Ppargc1a Rabbit Polyclonal Antibody

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032930

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Ppargc1a Rabbit Polyclonal Antibody (orb330035)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry