PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc)

SKU: orb1976441

Description

Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Salmonella typhimurium
• Biological Activity: Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785.
• Tag: N-6xHis, C-Myc
• Expression Region: 1-101 aa
• MW: 14.4 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P41785