Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Primate IFN beta protein

SKU: orb1215753

Description

The Gibbon IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Gibbon IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. Gibbon IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Gibbon IFN beta Specifications: (Molecular Weight: 20.1 kDa) (Amino Acid Sequence: MSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)) (Gene ID: 100598986).

Research Area

Product Categories/Products/Proteins

Images & Validation

Key Properties

SourceYeast
Biological OriginGibbon
TargetIFN beta
Protein Length166
MW20.1 kDa
Purity98%
Protein SequenceMSYNLLGFLQRRSSFQCQKLLWQLNGKLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAVFRQDLSSTGWNETIVENLLANVYHQIDHLKTVLEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTVVRVEILRNFFFINRLTGYLRN (166)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Primate beta receptor 1 protein [orb555732]

    50 μg, 10 μg, 1 mg, 500 μg
  • Primate IL 6 Protein [orb429415]

    Greater than 97.0% as determined by SDS-PAGE and HPLC analyses.

    Escherichia Coli

    0.1 mg, 2 μg, 10 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

25 μg
$ 470.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry