You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD14 |
| Target | PSMD14 |
| Protein Sequence | Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
| Molecular Weight | 35kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PSMD14 Rabbit Polyclonal Antibody [orb312510]
IF, IHC-Fr, IHC-P, WB
Bovine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlAnti-PSMD14 Antibody [orb411820]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlPSMD14 Rabbit Polyclonal Antibody [orb574213]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Lanes: 1. 100 ug HeLa cell lysate, 2. 100 ug mouse liver cytosolic extract 3. 1.5 ug human 26S Proteasome, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-Rabbit AP, Secondary Antibody dilution: 1:10000, Gene Name: PSMD14.

Rabbit Anti-PSMD14 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PSMD14 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, PSMD14 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
PSMD14 Rabbit Polyclonal Antibody (orb574212)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














