PTBP1 monoclonal antibody (M01), clone 3H8

SKU: orb2292315

Description

Mouse monoclonal antibody raised against a partial recombinant PTBP1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3H8
• Immunogen: PTBP1 (NP_002810, 45 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged PTBP1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PTBP1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PTBP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

Immunoprecipitation of PTBP1 transfected lysate using anti-PTBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTBP1 MaxPab rabbit polyclonal antibody.

PTBP1 monoclonal antibody (M01), clone 3H8 Western Blot analysis of PTBP1 expression in A-431.

Western Blot analysis of PTBP1 expression in transfected 293T cell line by PTBP1 monoclonal antibody (M01), clone 3H8. Lane 1: PTBP1 transfected lysate (59.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_002810