You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Cell Biology,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−
Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | PTGFRN |
| Protein Sequence | Synthetic peptide located within the following region: SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT |
| Molecular Weight | 98kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti CD315 antibody, anti CD9P-1 antibody, anti EWI-F antibody, anti FLJ11001 antibody, anti FPRP antibody, anti KIAA1436 antibody, anti SMAP-6 antibody
Similar Products
−- Item 1 of 6
PTGFRN antibody [C3], C-term [orb556498]
ICC, IHC-P, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 3
- Item 1 of 2
CD315 Polyclonal Antibody [orb1411134]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
- Item 1 of 1
- Item 1 of 1
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/p/t/ptgfrn-antibody_orb556498_ifa_1.jpg)
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/p/t/ptgfrn-antibody_orb556498_ihc_1.jpg)
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/p/t/ptgfrn-antibody_orb556498_ihc-p_1.jpg)
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/p/t/ptgfrn-antibody_orb556498_ihc-p_2.jpg)
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/p/t/ptgfrn-antibody_orb556498_wb_1.jpg)
![PTGFRN antibody [C3], C-term](/images/pub/media/catalog/product/g/p/gprc6a-antibody_orb556499_wb_1.jpg)
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks