PTPRB Protein, Human, Recombinant (His)

SKU: orb1977907

This product can be custom made

Description

PTPRB Protein, Human, Recombinant (His) is expressed in Yeast.

Research Area

,Recombinant-Protein

Images & Validation

−

Application Notes	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

−

Expression System	P. pastoris (Yeast)
Biological Origin	Human
Biological Activity	PTPRB Protein, Human, Recombinant (His) is expressed in Yeast.
Tag	N-6xHis
Expression Region	1643-1997 aa
MW	43.4 kDa (predicted)
Purity	98.00%
Protein Sequence	RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Storage & Handling

−

Storage	-20°C
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P23467

UniProt Details

−

No UniProt data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	98.00%
MW:	57.4 kDa (predicted)