QPCT Protein, Mouse, Recombinant (His & Myc)

SKU: orb1977240

Description

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 41.6 kDa and the accession number is Q9CYK2.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: HEK293 Cells
• Biological Origin: Mouse
• Biological Activity: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. QPCT Protein, Mouse, Recombinant (His & Myc) is expressed in HEK293 mammalian cells with N-6xHis-Myc tag. The predicted molecular weight is 41.6 kDa and the accession number is Q9CYK2.
• Tag: N-6xHis-Myc
• Expression Region: 36-362 aa
• MW: 41.6 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

Q9CYK2