You have no items in your shopping cart.
Rabies virus (RABV) (strain CVS-11) Matrix Protein (His & Myc)
SKU: orb1976695
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | E. coli |
|---|---|
| Biological Origin | RABV |
| Biological Activity | Plays a major role in assembly, budding and uncoating of virion after membrane fusion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Rabies virus (RABV) (strain CVS-11) Matrix Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 28.1 kDa and the accession number is P25223. |
| Tag | N-10xHis, C-Myc |
| Expression Region | 1-202 aa |
| MW | 28.1 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide