Rabies virus (RABV) (strain PM1503/AVO1) Matrix Protein (GST)

SKU: orb1976694

Description

Plays a major role in assembly, budding and uncoating of virion after membrane fusion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Rabies virus (RABV) (strain PM1503/AVO1) Matrix Protein (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 49.9 kDa and the accession number is P15200.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: E. coli
• Biological Origin: RABV
• Biological Activity: Plays a major role in assembly, budding and uncoating of virion after membrane fusion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Rabies virus (RABV) (strain PM1503/AVO1) Matrix Protein (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 49.9 kDa and the accession number is P15200.
• Tag: N-GST
• Expression Region: 1-202 aa
• MW: 49.9 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P15200