You have no items in your shopping cart.
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | Human |
| Biological Activity | RAC1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.6 kDa; 30 kDa, reducing conditions and the accession number is P63000. |
| Tag | C-6xHis |
| Expression Region | 1-189 aa |
| MW | 24.6 kDa (predicted); 30 kDa (reducing conditions) |
| Purity | 85.00% |
| Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 1
Recombinant human ARHGAP24 protein, C-His [orb1817208]
> 90% as determined by SDS-PAGE
24.3 kDa
500 μg, 100 μg Human RAC1 (His) Protein [orb428037]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mgRNASE1 Protein [orb1471892]
Greater than 90.0% as determined by SDS-PAGE.
HEK293 Cells
2 μg, 10 μg, 1 mgRecombinant Human Ribonuclease pancreatic(RNASE1) Protein, His Tag [orb1552998]
≥90% as determined by SDS-PAGE
This protein contains the human RNASE1(Lys29-Thr156)was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgPAK-3 Protein, Human, Recombinant (His) [orb1955343]
98.00%
62 kDa (predicted); 60 kDa (reducing conditions)
50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days