You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IF, IHC-P, WB |
|---|---|
| Reactivity | Human, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone No. | 3H7 |
| Immunogen | RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged RAD18 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25 ug/ml]

Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]

RAD18 monoclonal antibody (M01), clone 3H7 Western Blot analysis of RAD18 expression in Hela S3 NE.

RAD18 monoclonal antibody (M01), clone 3H7. Western Blot analysis of RAD18 expression in PC-12.

Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody (M01), clone 3H7. Lane 1: RAD18 transfected lysate(56.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody (M01), clone 3H7 (Cat # orb2290970). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).
Documents Download
Request a Document
Protocol Information
RAD18 monoclonal antibody (M01), clone 3H7 (orb2290970)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review