Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAD51 Rabbit Polyclonal Antibody

SKU: orb573908

Description

Rabbit polyclonal antibody to Rad51

Research Area

Product Categories/Antibodies/Primary Antibodies,Cancer,Epigenetics,Cancer/DNA Damage,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Signal Transduction,Root Catalog/Research Areas/DNA Damage & Repair,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51
TargetRAD51
Protein SequenceSynthetic peptide located within the following region: QLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYA
Molecular Weight37kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930

Similar Products

  • Rad51 Rabbit Polyclonal Antibody [orb317801]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Phospho-RAD51 (Thr309) Rabbit Polyclonal Antibody [orb4742]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
  • Rad51 rabbit pAb [orb766182]

    ELISA,  IHC-P,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Rad51 Rabbit Polyclonal Antibody [orb158250]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Anti-RAD51C Antibody [orb304540]

    IF,  IH,  WB

    Human, Primate

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RAD51 Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

RAD51 Rabbit Polyclonal Antibody

Rabbit Anti-RAD51 Antibody, Catalog Number: orb573908, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RAD51 Rabbit Polyclonal Antibody (orb573908)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry