RALY Rabbit Polyclonal Antibody

SKU: orb574923

Description

Rabbit polyclonal antibody to RALY

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RALY
• Target: RALY
• Protein Sequence: Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
• Molecular Weight: 32kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

P542, HNRPCL2

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

Human Brain

WB Suggested Anti-RALY Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate, RALY is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

RALY

UniProt

Q9UKM9

RefSeq (Protein):NP_031393