You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Epigenetics,Developmental Biology,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 27-214aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 26.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Vascular permeability factor , VPF
Similar Products
−Rat VEGFA protein [orb392698]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
P. pastoris
10 μg, 50 μg, 500 μgRat VEGFA Protein [orb2698640]
> 86%, determined by SDS-PAGE
This protein contains the rat VEGF 164 isoform (AAA41211.1) (Met 1-Arg 190) was expressed.
20 μg, 5 μgRecombinant Rat VEGFA/VEGF164 Protein, His Tag [orb1550607]
> 95% by SDS-PAGE.
Recombinant Rat VEGFA/VEGF164 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with an 6��His Tag at the C-terminus.
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks