RBMS1 Rabbit Polyclonal Antibody

SKU: orb330130

Description

Rabbit polyclonal antibody to RBMS1

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins,Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle,Root Catalog/Research Areas/Immunohistochemistry,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human RBMS1
Target	RBMS1
Protein Sequence	Synthetic peptide located within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ
Molecular Weight	44kDa
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	1.0 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti YC1 antibody, anti MSSP antibody, anti SCR2 antibody, anti HCC-4 antibody, anti MSSP-1 antibody, anti MSSP-2 antibody, anti MSSP-3 antibody, anti C2orf12 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 3 ug/mL.

Rabbit Anti-RBMS1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-RBMS1 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

RBMS1

UniProt

P29558

RefSeq (Protein):NP_002888

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002888

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols