You have no items in your shopping cart.
Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial
SKU: orb1096615
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Non-Animal,Infectious Diseases,Microbiology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 310-514aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 25.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(S glycoprotein)(E2)(Peplomer protein)
Similar Products
−Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial [orb1096665]
Greater than 85% as determined by SDS-PAGE.
24.3 kDa
Baculovirus
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide