You have no items in your shopping cart.
Recombinant Feline coronavirus Spike glycoprotein (S), Partial
SKU: orb2659410
Featured
Description
Research Area
,Microbiology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Feline coronavirus (strain FIPV WSU-79/1146) (FCoV) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 561-804aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 33.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | PMQDNNTDVYCIRSNQFSVYVHSTCKSSLWDNIFNQDCTDVLEATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVGVPSDNSGLHDLSVLHLDSCTDYNIYGRTGVGIIRRTNSTLLSGLYYTSLSGDLLGFKNVSDGVIYSVTPCDVSAQAAVIDGAIVGAMTSINSELLGLTHWTTTPNFYYYSIYNYTSERTRGTAIDSNDVDCEPV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−S glycoprotein;E2;Peplomer protein
Similar Products
−Feline coronavirus Spike glycoprotein Protein [orb1478004]
Greater than 85% as determined by SDS-PAGE.
18.0 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Feline coronavirus Spike glycoprotein (S), Partial [orb2659404]
Greater than 90% as determined by SDS-PAGE.
39.9 kDa
E.coli
1 mg, 20 μg, 100 μgRecombinant Feline coronavirus Spike glycoprotein (S), Partial [orb2659415]
Greater than 85% as determined by SDS-PAGE.
54.4 kDa
E.coli
20 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Feline coronavirus Spike glycoprotein (S), Partial (orb2659410)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review