You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | in vitro E.coli expression system |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 1-192aa |
| Protein Length | Full Length |
| Endotoxins | Not test. |
| MW | 46.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human Bax protein, DsbC & His [orb1516786]
> 95% as determined by SDS-PAGE
49.5 kDa
100 μgRecombinant Human Apoptosis regulator BAX (BAX) [orb2658872]
Greater than 85% as determined by SDS-PAGE.
47.6 kDa
in vitro E.coli expression system
100 μg, 20 μgRecombinant Human Apoptosis regulator BAX (BAX) [orb2659844]
Greater than 90% as determined by SDS-PAGE.
23.3 kDa
in vitro E.coli expression system
20 μg, 100 μgHuman BAX protein [orb391282]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human BAX Protein, His Tag [orb1552861]
≥90% as determined by SDS-PAGE
This protein contains the human BAX(Met1-Gln171) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
