You have no items in your shopping cart.
Recombinant Human Growth/differentiation factor 5 (GDF5)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 382-501aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 20.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human GDF5 protein [orb705307]
> 95 % as determined by SDS-PAGE and HPLC analyses.
13.6 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman GDF5 protein [orb706947]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgHuman GDF5 (His) Protein [orb425675]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 25 μgHuman GDF5 Protein [orb425674]
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mgHuman GDF5 protein [orb633456]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
34.5 KDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
