Recombinant Human Leukemia inhibitory factor (LIF) (Active)

SKU: orb2657908

Description

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

Research Area

,Others

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.
• Tag: Tag free
• Expression Region: 23-202aa
• Protein Length: Full Length of Mature Protein
• Endotoxins: ≤10 EU/mg by the LAL method
• MW: 19.7 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA

Quick Database Links

UniProt

P15018