You have no items in your shopping cart.
Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
SKU: orb2657940
Featured
Description
Research Area
,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured in a cell inhibition assay using TF-1 cells at IL4 presence. The ED50 for this effect is ≤0.1ng/mL. |
| Tag | Tag free |
| Expression Region | 279-390aa |
| Protein Length | Partial |
| Endotoxins | ≤10 EU/mg by the LAL method |
| MW | 12.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containing 100 mM Glycine,5%mannitoland0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
Similar Products
−Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active) [orb2657941]
Greater than 95% as determined by SDS-PAGE.
12.8 kDa
Mammalian cell
10 μg, 50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide