You have no items in your shopping cart.
Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial, Biotinylated (Active)
SKU: orb1095892
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 at 5 μg/ml can bind Biotinylated human TNFSF14, the EC50 is 1.773-3.707 ng/ml. |
| Tag | N-terminal hFc-Avi-tagged |
| Expression Region | 74-240aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 47.3 kDa |
| Purity | Greater than 92% as determined by SDS-PAGE. |
| Protein Sequence | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

