You have no items in your shopping cart.
Description
Research Area
Product Categories/Proteins
Images & Validation
−
| Tested Applications | ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Biological Activity | Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is < 1.2 ng/mL. |
| Reactivity | Human |
| Tag | His-tag at the N-terminus |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Purity | > 98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Melanoma differentiation-associated protein-like protein
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
ELISA
Enzyme-linked Immunosorbent Assay (EIA)
Available Sizes
Select a size below
Usually dispatched within 5-10 working days