You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 24-92aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 11.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Immune activation protein 2 , ACT-2 , ACT2Macrophage inflammatory protein 1-beta , MIP-1-betaProtein H400SIS-gamma, Small-inducible cytokine A4
Similar Products
−Recombinant Mouse C-C motif chemokine 4 protein(Ccl4) (Active) [orb1650794]
10 μg, 100 μg, 500 μg, 1 mg, 250 μgMouse MIP 1b Protein [orb427121]
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
1 mg, 2 μg, 10 μgRecombinant CCL4 (C-C Motif Chemokine Ligand 4), Mouse, AF [orb1178998]
ELISA
> 98% as determined by SDS-PAGE. Ni-NTA chromatography.
Escherichia coli
5 μg, 100 μg, 500 μg, 1 mg, 20 μgMouse CCL4 protein [orb754138]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
7.5 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide