You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| MW | 15.5 kDa |
| Protein Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Mouse IFN gamma protein [orb604180]
Greater than 90% as determined by SDS-PAGE.
19.1 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Il18 protein [orb604186]
Greater than 85% as determined by SDS-PAGE.
26.1 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K) [orb1674441]
Greater than 90% as determined by SDS-PAGE.
24.0 kDa
E.coli
1 mg, 20 μg, 100 μgRecombinant Mouse Interleukin-18 (Il18) (N36H,M85A,K87G,E90R,V91A,L94K) [orb1674645]
Greater than 85% as determined by SDS-PAGE.
20.5 kDa
Yeast
1 mg, 100 μg, 20 μg- Item 1 of 1
Recombinant mouse IL18 protein, N-His [orb1808082]
> 90% as determined by SDS-PAGE
18.9 kDa
500 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days