Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Mouse VEGF-A

SKU: orb623194

Description

VEGF-A is member of the family of vascular endothelial growth factor (VEGF) proteins, which stimulate vasculogenesis and angiogenesis to restore oxygen supply to tissues. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF). Mouse VEGF-A Recombinant Protein is purified vascular endothelial growth factor A produced in yeast.

Images & Validation

Application Notes
The Mouse IL-2 protein can be used in cell culture, as an IL-2 ELISA Standard, and as a Western Blot Control.

Key Properties

SourceYeast
MW19.3 kDa
Protein SequenceAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCC NDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCS ERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Mouse VEGFA protein [orb392697]

    ELISA,  MS,  SDS-PAGE,  WB

    Greater than 95% as determined by reducing SDS-PAGE.

    P. pastoris

    50 μg, 500 μg, 10 μg
  • Recombinant Mouse VEGF (164aa) [orb1673094]

    > 95% as determined by SDS-PAGE

    19.6 kDa

    E. coli

    1 mg
  • Recombinant Mouse VEGF (164aa) [orb1673095]

    > 95% as determined by SDS-PAGE

    19.6 kDa

    E. coli

    100 μg
  • Recombinant Mouse VEGF (164aa) [orb1673096]

    > 95% as determined by SDS-PAGE

    19.6 kDa

    E. coli

    10 μg
  • Recombinant Mouse VEGF (120aa) [orb1673097]

    > 95% as determined by SDS-PAGE

    28 kDa

    E. coli

    1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry