Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial

SKU: orb1096685

Description

Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein(S),partial

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Non-Animal,Infectious Diseases,Microbiology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: Mammalian cell
• Biological Origin: Severe acute respiratory syndrome coronavirus (SARS-CoV)
• Tag: C-terminal 6xHis-tagged
• Expression Region: 306-527aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• MW: 27.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

(S glycoprotein)(E2)(Peplomer protein)

Quick Database Links

UniProt

P59594