You have no items in your shopping cart.
Recombinant TWEAK (TNF-related weak inducer of apoptosis), Mouse, AF
SKU: orb1178918
Description
Research Area
Product Categories/Proteins
Images & Validation
−
| Tested Applications | ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Biological Activity | Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is < 0.2 μg/mL. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
| Purity | > 98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing in 1X PBS, pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TNFSF12, DR3LG, Apo3 Ligand, AI255180, C87282, Fn1, Fn14, HPIP, TWEAK-R, Twea, TweakR, Tnfrsf12a

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
ELISA
Enzyme-linked Immunosorbent Assay (EIA)