You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Mouse, Porcine, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A |
| Target | RNASEH2A |
| Protein Sequence | Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE |
| Molecular Weight | 33 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RNASEH2A Rabbit Polyclonal Antibody [orb324882]
IHC, WB
Human
Human
Rabbit
Polyclonal
Unconjugated
100 μlRNASEH2A Rabbit Polyclonal Antibody [orb514949]
ELISA, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μgRNASEH2A Rabbit Polyclonal Antibody (Biotin) [orb2125141]
IHC, WB
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Yeast, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Rabbit Anti-RNASEH2A Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-RNASEH2A Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, RNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat.
Documents Download
Request a Document
Protocol Information
RNASEH2A Rabbit Polyclonal Antibody (orb324883)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

