Rnf216 Rabbit Polyclonal Antibody

SKU: orb583731

Description

Rabbit polyclonal antibody to Rnf216

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Cancer,Epigenetics,Signaling Pathways/Apoptotic,Neuroscience,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Apoptosis,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/Disease Related,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216
• Target: Rnf216
• Protein Sequence: Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
• Molecular Weight: 93kDa
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

UIP, UIP83, C86502, TRIAD3, Ubce7i, AI647468, AU019462, Ubce7ip1, 2810055G22Rik, F830018F18Rik

Quick Database Links

Gene Symbol

Rnf216

UniProt

P58283