RPS7 monoclonal antibody (M03), clone 3G4

SKU: orb2292238

Description

Mouse monoclonal antibody raised against a partial recombinant RPS7.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 3G4
• Immunogen: RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged RPS7 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell. [antibody concentration 20 ug/ml]

Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

RPS7 monoclonal antibody (M03), clone 3G4 Western Blot analysis of RPS7 expression in HeLa.

RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in NIH/3T3.

RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in PC-12.

RPS7 monoclonal antibody (M03), clone 3G4. Western Blot analysis of RPS7 expression in Raw 264.7.

Western Blot detection against Immunogen (36.74 KDa).

Quick Database Links

RefSeq (Protein):NP_001002