RRAS2 monoclonal antibody (M01), clone 2D3-4B8

SKU: orb2291395

Description

Mouse monoclonal antibody raised against a full length recombinant RRAS2.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone No.: 2D3-4B8
• Immunogen: RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged RRAS2 is 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RRAS2 on A-431 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. [antibody concentration 5 ug/ml]

RRAS2 monoclonal antibody (M01), clone 2D3-4B8 Western Blot analysis of RRAS2 expression in A-431.

RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in HeLa.

RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in NIH/3T3.

RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in PC-12.

RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Western Blot analysis of RRAS2 expression in Raw 264.7.

Western Blot analysis of RRAS2 expression in transfected 293T cell line by RRAS2 monoclonal antibody (M01), clone 2D3-4B8. Lane 1: RRAS2 transfected lysate (Predicted MW: 23.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (48.18 KDa).

Quick Database Links

RefSeq:AAH13106