SAE1 monoclonal antibody (M01), clone 1G4-1G5

SKU: orb2291630

Description

Mouse monoclonal antibody raised against a full length recombinant SAE1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 lambda
• Clone No.: 1G4-1G5
• Immunogen: SAE1 (AAH00344, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Western Blot detection against Immunogen (63.8 KDa).

Detection limit for recombinant GST tagged SAE1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SAE1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SAE1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]

SAE1 monoclonal antibody (M01), clone 1G4-1G5 Western Blot analysis of SAE1 expression in HeLa.

Quick Database Links

RefSeq:AAH00344