You have no items in your shopping cart.
Saposin-B-Val Protein, Pig, Recombinant (Flag & His)
SKU: orb1976795
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | Sus scrofa (Pig) |
| Biological Activity | Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Saposin-B-Val Protein, Pig, Recombinant (Flag & His) is expressed in yeast with N-6xHis-Flag tag. The predicted molecular weight is 11.9 kDa and the accession number is P81405. |
| Tag | N-6xHis-Flag |
| Expression Region | 1-80 aa |
| MW | 11.9 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide