SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc)

SKU: orb1976429

Description

SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc) is expressed in HEK293 mammalian cells with C-hFC-Flag tag. The predicted molecular weight is 44.5 kDa and the accession number is P0DTD1 YP_009742616.1.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: HEK293 Cells
• Biological Origin: SARS-CoV-2
• Biological Activity: SARS-CoV-2 Non-structural protein 9/NSP9 Protein (Flag & hFc) is expressed in HEK293 mammalian cells with C-hFC-Flag tag. The predicted molecular weight is 44.5 kDa and the accession number is P0DTD1 YP_009742616.1.
• Tag: C-hFC-Flag
• Expression Region: 1-113 aa
• MW: 44.5 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P0DTD1